PDB entry 2hi0

View 2hi0 on RCSB PDB site
Description: Crystal structure of putative phosphoglycolate phosphatase (YP_619066.1) from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 at 1.51 A resolution
Class: hydrolase
Keywords: YP_619066.1, putative, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, hydrolase
Deposited on 2006-06-28, released 2006-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative phosphoglycolate phosphatase
    Species: Lactobacillus delbrueckii [TaxId:1584]
    Gene: YP_619066.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1GA24 (1-239)
      • leader sequence (0)
      • see remark 999 (79)
      • see remark 999 (87)
      • see remark 999 (109)
    Domains in SCOPe 2.07: d2hi0a1, d2hi0a2
  • Chain 'B':
    Compound: Putative phosphoglycolate phosphatase
    Species: Lactobacillus delbrueckii [TaxId:1584]
    Gene: YP_619066.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1GA24 (1-239)
      • see remark 999 (79)
      • see remark 999 (87)
      • see remark 999 (109)
    Domains in SCOPe 2.07: d2hi0b_
  • Heterogens: NA, CL, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hi0A (A:)
    gmkykaaifdmdgtildtsadltsalnyafeqtghrhdftvediknffgsgvvvavtral
    ayeagssreslvafgtkdeqipeavtqtevnrvlevfkpyyadhcqiktgpfpgildlmk
    nlrqkgvklavvsnkpneavqvlveelfpgsfdfalgeksgirrkpapdmtsecvkvlgv
    prdkcvyigdseidiqtarnsemdeiavnwgfrsvpflqkhgatvivdtaekleeailge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hi0B (B:)
    gmkykaaifdmdgtildtsadltsalnyafeqtghrhdftvediknffgsgvvvavtral
    ayeagssreslvafgtkdeqipeavtqtevnrvlevfkpyyadhcqiktgpfpgildlmk
    nlrqkgvklavvsnkpneavqvlveelfpgsfdfalgeksgirrkpapdmtsecvkvlgv
    prdkcvyigdseidiqtarnsemdeiavnwgfrsvpflqkhgatvivdtaekleeailge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hi0B (B:)
    mkykaaifdmdgtildtsadltsalnyafeqtghrhdftvediknffgsgvvvavtrala
    yeagssreslvafgtkdeqipeavtqtevnrvlevfkpyyadhcqiktgpfpgildlmkn
    lrqkgvklavvsnkpneavqvlveelfpgsfdfalgeksgirrkpapdmtsecvkvlgvp
    rdkcvyigdseidiqtarnsemdeiavnwgfrsvpflqkhgatvivdtaekleeailge