PDB entry 2hht

View 2hht on RCSB PDB site
Description: C:O6-methyl-guanine pair in the polymerase-2 basepair position
Class: Transferase/DNA
Keywords: DNA polymerase I, DNA replication, Klenow fragment, Protein-DNA complex, O6-methyl-guanine
Deposited on 2006-06-28, released 2006-12-12
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.197
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase I
    Species: Bacillus stearothermophilus
    Gene: polA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hhta1, d2hhta2
  • Chain 'B':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*ap*gp*cp*tp*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*gp*tp*ap*cp*(6og)p*ap*gp*cp*tp*gp*ap*tp*cp*gp*cp*a)-3'
    Species: synthetic, synthetic
  • Heterogens: SUC, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hhtA (A:)
    kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    pdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnfgivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.