PDB entry 2hhn

View 2hhn on RCSB PDB site
Description: Cathepsin S in complex with non covalent arylaminoethyl amide.
Class: hydrolase
Keywords: cathepsin S, noncovalent, inhibition, arylaminoethyl amide, protease, HYDROLASE
Deposited on 2006-06-28, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hhna_
  • Chain 'B':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hhnb_
  • Heterogens: SO4, GNQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hhnA (A:)
    nrilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcs
    tekygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelp
    ygredvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngk
    eywlvknswghnfgeegyirmarnkgnhcgiasfpsypei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hhnB (B:)
    nrilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcs
    tekygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelp
    ygredvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngk
    eywlvknswghnfgeegyirmarnkgnhcgiasfpsypei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hhnB (B:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei