PDB entry 2hh6

View 2hh6 on RCSB PDB site
Description: Crystal structure of BH3980 (10176605) from BACILLUS HALODURANS at 2.04 A resolution
Class: STRUCTURAL GENOMICS, unknown function
Keywords: 10176605, BH3980, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, unknown function
Deposited on 2006-06-27, released 2006-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH3980 protein
    Species: Bacillus halodurans [TaxId:86665]
    Gene: 10176605
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5V7 (1-112)
      • modified residue (1)
      • modified residue (7)
      • modified residue (20)
      • modified residue (42)
      • modified residue (91)
      • modified residue (98)
    Domains in SCOPe 2.07: d2hh6a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hh6A (A:)
    gmsfiekmigslndkrewkamearakalpkeyhhaykaiqkymwtsggptdwqdtkrifg
    gildlfeegaaegkkvtdltgedvaafcdelmkdtktwmdkyrtklndsigrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hh6A (A:)
    msfiekmigslndkrewkamearakalpkeyhhaykaiqkymwtsggptdwqdtkrifgg
    ildlfeegaaegkkvtdltgedvaafcdelmkdtktwmdkyrtklndsigrd