PDB entry 2hh2

View 2hh2 on RCSB PDB site
Description: Solution structure of the fourth KH domain of KSRP
Class: RNA binding protein
Keywords: KH-RNA binding domain, RNA BINDING PROTEIN
Deposited on 2006-06-27, released 2007-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KH-type splicing regulatory protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2hh2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hh2A (A:)
gamapggemtfsipthkcglvigrggenvkainqqtgafveisrqlppngdpnfklfiir
gspqqidhakqlieekiegplcpvgpgpggpgpagpmgpfnpgpfnq

    Sequence, based on observed residues (ATOM records): (download) 
    >2hh2A (A:)
gemtfsipthkcglvigrggenvkainqqtgafveisrqlppngdpnfklfiirgspqqi
dhakqlieekiegplcpvg