PDB entry 2hgz

View 2hgz on RCSB PDB site
Description: Crystal structure of a p-benzoyl-L-phenylalanyl-tRNA synthetase
Class: ligase
Keywords: p-benzoyl-L-phenylalanine, Unnatural amino acid, aminoacyl-tRNA synthetase, LIGASE
Deposited on 2006-06-27, released 2007-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-304)
      • engineered (30)
      • see remark 999 (105)
      • engineered (156-157)
      • see remark 999 (159)
      • see remark 999 (188)
      • cloning artifact (305)
    Domains in SCOPe 2.06: d2hgza1, d2hgza2
  • Heterogens: PBF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hgzA (A:)
defemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagfd
iiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygspfqldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimqvntshrlgvdvavggmeqrkihmlar
ellpkkvvmihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrll