PDB entry 2hgk

View 2hgk on RCSB PDB site
Description: Solution NMR Structure of protein YqcC from E. coli: Northeast Structural Genomics Consortium target ER225
Class: structural genomics, unknown function
Keywords: helical bundle, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-06-27, released 2007-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yqcC
    Species: Escherichia coli [TaxId:562]
    Gene: yqcC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46919 (0-108)
      • expression tag (109-116)
    Domains in SCOPe 2.06: d2hgka1, d2hgka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hgkA (A:)
mtthdrvrlqlqaleallrehqhwrndepqphqfnstqpffmdtmeplewlqwvliprmh
dlldnkqplpgafavapyyemalatdhpqralilaelekldalfaddaslehhhhhh