PDB entry 2hgj

View 2hgj on RCSB PDB site
Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
Class: ribosome
Keywords: ribosome, no-template, codon-mimicry
Deposited on 2006-06-27, released 2006-11-07
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 5 Å
R-factor: 0.263
AEROSPACI score: -0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgj11
  • Chain '2':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgj21
  • Chain '3':
    Compound: 50S ribosomal protein L31
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgj31
  • Chain '4':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgj41
  • Chain '5':
    Compound: 50S ribosomal protein L33
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgj51
  • Chain '6':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgj61
  • Chain '7':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgj71
  • Chain '8':
    Compound: 50S ribosomal protein L36
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgj81
  • Chain 'A':
    Compound: 23S ribosomal RNA
    Species: Thermus thermophilus
  • Chain 'B':
    Compound: 5S ribosomal RNA
    Species: Thermus thermophilus
  • Chain 'C':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjc1
  • Chain 'D':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjd1, d2hgjd2
  • Chain 'E':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgje1
  • Chain 'F':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjf1
  • Chain 'G':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjg1
  • Chain 'H':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjh1, d2hgjh2
  • Chain 'K':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjk1, d2hgjk2
  • Chain 'L':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjl1, d2hgjl2
  • Chain 'M':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjm1
  • Chain 'N':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjn1
  • Chain 'O':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjo1
  • Chain 'P':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjp1
  • Chain 'Q':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjq1
  • Chain 'R':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjr1
  • Chain 'S':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjt1
  • Chain 'U':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgju1
  • Chain 'V':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjv1
  • Chain 'W':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjw1
  • Chain 'X':
    Compound: 50S ribosomal protein L24
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjx1
  • Chain 'Y':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hgjy1
  • Chain 'Z':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgj1 (1:)
    mrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarlltvln
    ekrrqna
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2hgj2 (2:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgj2 (2:)
    prlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgj3 (3:)
    mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfvdtegrverfq
    rrygdsyrkgr
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2hgj4 (4:)
    makhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgj4 (4:)
    hpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2hgj5 (5:)
    masevriklllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgj5 (5:)
    riklllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevki
    

  • Chain '6':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgj6 (6:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >2hgj7 (7:)
    mpkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikl
    llpye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgj7 (7:)
    mpkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikl
    llpy
    

  • Chain '8':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgj8 (8:)
    mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg
    

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hgjC (C:)
    mpkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvr
    gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
    mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkas
    fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjC (C:)
    pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
    tvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvm
    gavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasf
    ppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hgjD (D:)
    mavkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkr
    lyriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvag
    pdapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsg
    elrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegra
    prgrppaspwgwqtkglktrkrrkpssrfiiarrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjD (D:)
    kfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrlyri
    idfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagpdap
    iqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsgelrk
    vhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegraprgr
    ppaspwgwqtkglktrkrrkpssrfiiarrkk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgjE (E:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hgjF (F:)
    mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
    grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
    gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
    lnvydivrterlvmdldawevfqnriggea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjF (F:)
    evavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgr
    kiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregk
    lllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapegln
    vydivrterlvmdldawevfqnriggea
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgjG (G:)
    mpldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqel
    alitgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgl
    npnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpf
    rk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hgjH (H:)
    msrigrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderr
    hkslhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppeg
    itfevpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjH (H:)
    igrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderrhks
    lhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppegitf
    evpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkag
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgjK (K:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkkilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvvaqe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2hgjL (L:)
    mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
    adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
    eaaarmiagsarsmgvevvgapevkda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjL (L:)
    kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
    drsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdle
    aaarmiagsarsmgvevv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2hgjM (M:)
    mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
    rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
    kvyagpdhphqaqrpeklev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjM (M:)
    ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir
    vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk
    vyagpdhphqaqrpeklev
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgjN (N:)
    miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
    vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
    vl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2hgjO (O:)
    mklsdlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlm
    rlpkrgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegea
    kplkvvahafsksaleklkaaggepvllea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjO (O:)
    lrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpkr
    gmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplkv
    vahafsksaleklkaaggepvllea
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2hgjP (P:)
    mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
    ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
    aghklpiktkivrrdaydeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjP (P:)
    rmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkif
    irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl
    piktkivrrdaydeaq
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2hgjQ (Q:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjQ (Q:)
    rhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlh
    arrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2hgjR (R:)
    marltayerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkg
    nktevarqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjR (R:)
    rltayerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnk
    tevarqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2hgjT (T:)
    mpraktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrl
    wivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjT (T:)
    praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
    ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgjU (U:)
    mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
    vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2hgjV (V:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjV (V:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2hgjW (W:)
    mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
    gkkkrlgrylgkrpdrkkaivqvapgqkiealegli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjW (W:)
    taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
    kkrlgrylgkrpdrkkaivqvapgqkiealegli
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hgjX (X:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcggaldtee
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2hgjY (Y:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklaeeaaaevaepevikkgkeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgjY (Y:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    

  • Chain 'Z':
    No sequence available.