PDB entry 2hgh

View 2hgh on RCSB PDB site
Description: Transcription Factor IIIA zinc fingers 4-6 bound to 5S rRNA 55mer (NMR structure)
Class: transcription/RNA
Keywords: zinc finger
Deposited on 2006-06-27, released 2006-08-01
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor iiia
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03001 (1-86)
      • initiating methionine (0)
    Domains in SCOP 1.73: d2hgha1, d2hgha2, d2hgha3
  • Chain 'B':
    Compound: 55-mer
    Species: synthetic, synthetic
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hghA (A:)
    myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
    ckkddscsfvgktwtlylkhvaechqd
    

  • Chain 'B':
    No sequence available.