PDB entry 2hgh

View 2hgh on RCSB PDB site
Description: Transcription Factor IIIA zinc fingers 4-6 bound to 5S rRNA 55mer (NMR structure)
Class: transcription/RNA
Keywords: zinc finger, TRANSCRIPTION-RNA COMPLEX
Deposited on 2006-06-27, released 2006-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription factor iiia
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03001 (1-86)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d2hgha1, d2hgha2, d2hgha3
• Chain 'B':
  Compound: 55-mer
  Species: synthetic, synthetic
  
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hghA (A:)
  myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
  ckkddscsfvgktwtlylkhvaechqd
  

  
  
• Chain 'B':
  No sequence available.