PDB entry 2hgc

View 2hgc on RCSB PDB site
Description: Solution NMR structure of the YjcQ protein from Bacillus subtilis. Northeast Structural Genomics target SR346.
Class: structural genomics, unknown function
Keywords: SR346, NMR structure, AutoStructure, NESG, PSI-2, Northeast Structural Genomics Consortium, Protein Structure Initiative, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2006-06-26, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: YjcQ protein
  Species: Bacillus subtilis [TaxId:1423]
  Gene: yjcQ
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31639
  Domains in SCOPe 2.08: d2hgca1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hgcA (A:)
  mnkdklryailkeifegntplsendigvtedqfddavnflkregyiigvhysddrphlyk
  lgpeltekgenylkengtwskayktikeikdwiklehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hgcA (A:)
  klryailkeifegntplsendigvtedqfddavnflkregyiigvhysddrphlyklgpe
  ltekgenylkengtwska