PDB entry 2hg5

View 2hg5 on RCSB PDB site
Description: Cs+ complex of a K channel with an amide to ester substitution in the selectivity filter
Class: membrane protein
Keywords: Channel, semi-synthetic, ester, MEMBRANE PROTEIN
Deposited on 2006-06-26, released 2006-09-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.239
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HG5 (0-218)
  • Chain 'B':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HG5 (0-211)
  • Chain 'C':
    Compound: KcsA Channel
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2hg5c1
  • Chain 'D':
    Compound: KcsA Channel
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2HG5 (0-42)
    Domains in SCOPe 2.05: d2hg5d1
  • Heterogens: CS, GOA, B3H, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hg5C (C:)
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvgy

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hg5D (D:)
dlypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerr