PDB entry 2hfv

View 2hfv on RCSB PDB site
Description: Solution NMR Structure of Protein RPA1041 from Pseudomonas aeruginosa. Northeast Structural Genomics Consortium Target PaT90.
Class: structural genomics, unknown function
Keywords: NESG, GFT-NMR, alpha+beta, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-06-26, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical Protein RPA1041
  Species: Pseudomonas aeruginosa [TaxId:287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6NAY9 (23-96)
  Domains in SCOPe 2.08: d2hfva1, d2hfva2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hfvA (A:)
  mgsshhhhhhssgrenlyfqghlrellrtndavllsavgalldgadighlvldqnmsile
  gslgviprrvlvheddlagarrlltdaglahelrsdd