PDB entry 2hfo

View 2hfo on RCSB PDB site
Description: Crystal Structures of the Synechocystis Photoreceptor Slr1694 Reveal Distinct Structural States Related to Signaling
Class: electron transport
Keywords: Beta Sheet ferredoxin-like fold, flavin binding protein, photoreceptor, ELECTRON TRANSPORT
Deposited on 2006-06-24, released 2006-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.239
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfoa_
  • Chain 'B':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfob_
  • Chain 'C':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfoc_
  • Chain 'D':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfod_
  • Chain 'E':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfoe_
  • Chain 'F':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfof_
  • Chain 'G':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfog_
  • Chain 'H':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfoh_
  • Chain 'I':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfoi_
  • Chain 'J':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hfoj_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hfoA (A:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoA (A:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiyelsdnffldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hfoB (B:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoB (B:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hfoC (C:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoC (C:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaisteqvktlvlkysgfttlrpsamd
    peqclnflldiakiye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hfoD (D:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoD (D:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiyelsdnff
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2hfoE (E:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoE (E:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hfoF (F:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoF (F:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2hfoG (G:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoG (G:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiaki
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hfoH (H:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoH (H:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiye
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2hfoI (I:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoI (I:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiyel
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2hfoJ (J:)
    aghmslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegece
    qvnetyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgft
    tlrpsamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfoJ (J:)
    mslyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevmqaitvndlsteqvktlvlkysgfttlrps
    amdpeqclnflldiakiye