PDB entry 2hfk

View 2hfk on RCSB PDB site
Description: Pikromycin thioesterase in complex with product 10-deoxymethynolide
Class: hydrolase
Keywords: alpha/beta hydrolase, thioesterase, hydrolase
Deposited on 2006-06-24, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type I polyketide synthase PikAIV
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Gene: pikAIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZGI2
      • engineered (168)
    Domains in SCOPe 2.07: d2hfka_
  • Chain 'B':
    Compound: Type I polyketide synthase PikAIV
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Gene: pikAIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZGI2
      • engineered (168)
    Domains in SCOPe 2.07: d2hfkb_
  • Heterogens: SO4, MG, DMS, E4H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hfkA (A:)
    mgsshhhhhhssglvprgshmsgadtgagagmfralfrqaveddrygefldvlaeasafr
    pqfaspeacserldpvllaggptdraegravlvgctgtaanggpheflrlstsfqeerdf
    lavplpgygtgtgtgtallpadldtaldaqarailraagdapvvllghaggallahelaf
    rlerahgappagivlvdpyppghqepievwsrqlgeglfagelepmsdarllamgryarf
    lagprpgrssapvllvraseplgdwqeergdwrahwdlphtvadvpgdhftmmrdhapav
    aeavlswldaiegiegagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfkA (A:)
    agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllaggptdaegra
    vlvgctgtaanggpheflrlstsfqeerdflavplpgygtggtallpadldtaldaqara
    ilraagdapvvllghaggallahelafrlerahgappagivlvdpyppghqepievwsrq
    lgeglfagelepmsdarllamgryarflagprpgrssapvllvraseplgdwqeergdwr
    ahwdlphtvadvpgdhftmmrdhapavaeavlswldaieg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hfkB (B:)
    mgsshhhhhhssglvprgshmsgadtgagagmfralfrqaveddrygefldvlaeasafr
    pqfaspeacserldpvllaggptdraegravlvgctgtaanggpheflrlstsfqeerdf
    lavplpgygtgtgtgtallpadldtaldaqarailraagdapvvllghaggallahelaf
    rlerahgappagivlvdpyppghqepievwsrqlgeglfagelepmsdarllamgryarf
    lagprpgrssapvllvraseplgdwqeergdwrahwdlphtvadvpgdhftmmrdhapav
    aeavlswldaiegiegagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfkB (B:)
    agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllaggptdegrav
    lvgctgtaanggpheflrlstsfqeerdflavplpgygtgtallpadldtaldaqarail
    raagdapvvllghaggallahelafrlerahgappagivlvdpyppghqepievwsrqlg
    eglfagelepmsdarllamgryarflagprpgrssapvllvraseplgdwqeergdwrah
    wdlphtvadvpgdhftmmrdhapavaeavlswldaie