PDB entry 2hfi

View 2hfi on RCSB PDB site
Description: Solution NMR Structure of Protein yppE from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR213
Class: structural genomics, unknown function
Keywords: yppe_bacsu, gft nmr, structural genomics, psi, protein structure initiative, northeast structural genomics consortium, nesg
Deposited on 2006-06-23, released 2006-07-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein yppE
  Species: Bacillus subtilis
  Gene: yppE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50833 (0-122)
  Domains in SCOP 1.73: d2hfia1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hfiA (A:)
  mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
  likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiare
  dsrlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hfiA (A:)
  mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
  likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiare
  dsr