PDB entry 2hff

View 2hff on RCSB PDB site
Description: Crystal structure of CB2 Fab
Class: immune system
Keywords: fab fragment, phage libraries, combinatorial selection, IMMUNE SYSTEM
Deposited on 2006-06-23, released 2006-11-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CB2 Fab, light chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HFF (Start-213)
    Domains in SCOPe 2.03: d2hffa1, d2hffa2
  • Chain 'B':
    Compound: CB2 Fab, heavy chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HFF (0-End)
    Domains in SCOPe 2.03: d2hffb1, d2hffb2
  • Chain 'H':
    Compound: CB2 Fab, heavy chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HFF (0-End)
    Domains in SCOPe 2.03: d2hffh1, d2hffh2
  • Chain 'L':
    Compound: CB2 Fab, light chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HFF (0-End)
    Domains in SCOPe 2.03: d2hffl1, d2hffl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hffA (A:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsritpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hffA (A:)
    iqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsritpptfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hffB (B:)
    evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
    adsvkgrftisadtskntaylqmnslraedtavyycarrvcynrlgvcaggmdywgqgtl
    vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
    vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hffB (B:)
    evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
    adsvkgrftisadtskntaylqmnslraedtavyycarrvcyaggmdywgqgtlvtvssa
    stkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hffH (H:)
    evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
    adsvkgrftisadtskntaylqmnslraedtavyycarrvcynrlgvcaggmdywgqgtl
    vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
    vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hffH (H:)
    evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
    adsvkgrftisadtskntaylqmnslraedtavyycarrvcaggmdywgqgtlvtvssas
    tkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2hffL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsritpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hffL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsritpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr