PDB entry 2hff

View 2hff on RCSB PDB site
Description: Crystal structure of CB2 Fab
Class: immune system
Keywords: fab fragment, phage libraries, combinatorial selection
Deposited on 2006-06-23, released 2006-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-07, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.192
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CB2 Fab, light chain
    Species: Homo sapiens, synthetic
  • Chain 'B':
    Compound: CB2 Fab, heavy chain
    Species: Homo sapiens, synthetic
    Domains in SCOP 1.73: d2hffb1, d2hffb2
  • Chain 'H':
    Compound: CB2 Fab, heavy chain
    Species: Homo sapiens, synthetic
    Domains in SCOP 1.73: d2hffh1, d2hffh2
  • Chain 'L':
    Compound: CB2 Fab, light chain
    Species: Homo sapiens, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hffB (B:)
    evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
    adsvkgrftisadtskntaylqmnslraedtavyycarrvcynrlgvcaggmdywgqgtl
    vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
    vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hffB (B:)
    evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
    adsvkgrftisadtskntaylqmnslraedtavyycarrvcyaggmdywgqgtlvtvssa
    stkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hffH (H:)
    evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
    adsvkgrftisadtskntaylqmnslraedtavyycarrvcynrlgvcaggmdywgqgtl
    vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
    vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hffH (H:)
    evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
    adsvkgrftisadtskntaylqmnslraedtavyycarrvcaggmdywgqgtlvtvssas
    tkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    No sequence available.