PDB entry 2hfe

View 2hfe on RCSB PDB site
Description: Rb+ complex of a K channel with an amide to ester substitution in the selectivity filter
Class: membrane protein
Keywords: channel, semi-synthetic, ester
Deposited on 2006-06-23, released 2006-09-12
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-19, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.232
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Fab light chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: KcsA Channel
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hfec1
  • Chain 'D':
    Compound: KcsA Channel
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hfed1
  • Heterogens: RB, GOA, B3H, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hfeC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvgy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hfeD (D:)
    dlypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerr