PDB entry 2hfd

View 2hfd on RCSB PDB site
Description: NMR structure of protein Hydrogenase-1 operon protein hyaE from Escherichia coli: Northeast Structural Genomics Consortium Target ER415
Class: structural genomics, unknown function
Keywords: PROTEIN STRUCTURE, NESGC, ALFA-BETA, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-06-23, released 2006-08-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Escherichia coli [TaxId:562]
    Gene: hyaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2hfda1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hfdA (A:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llrefpdytwqvaiadleqseaigdrfgvfrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfdA (A:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llrefpdytwqvaiadleqseaigdrfgvfrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeras