PDB entry 2hf7

View 2hf7 on RCSB PDB site
Description: Transition State Analogue of AphA class B Acid Phosphatase/Phosphotransferase (Aluminium Fluoride Complex)
Class: hydrolase
Keywords: Apha class B Acid phosphatase/phosphotransferase - Transition state analogue, HYDROLASE
Deposited on 2006-06-23, released 2008-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.174
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hf7a_
  • Chain 'B':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hf7b_
  • Heterogens: MG, AF3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hf7A (A:)
    spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
    tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
    vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
    girilrasnstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hf7B (B:)
    spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
    tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
    vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
    girilrasnstykplpqagafgeevivnsey