PDB entry 2hf5

View 2hf5 on RCSB PDB site
Description: The structure and function of a novel two-site calcium-binding fragment of calmodulin
Class: metal binding protein
Keywords: calmodulin fragment, calcium-binding, EF-hand, calmodulin, HLH, METAL BINDING PROTEIN
Deposited on 2006-06-23, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CAM3, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hf5a1
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hf5A (A:)
    aelqdminevdadgngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaael
    rhvmtnlg