PDB entry 2hf4

View 2hf4 on RCSB PDB site
Description: Crystal structure of Monomeric Actin in its ATP-bound state
Class: contractile protein
Keywords: Motor protein, CONTRACTILE PROTEIN
Deposited on 2006-06-22, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-5C
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10987 (0-373)
      • engineered (202)
      • engineered (241)
    Domains in SCOPe 2.07: d2hf4a1, d2hf4a2
  • Heterogens: CA, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hf4A (A:)
    deevaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
    rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
    imfetfntpamyvaiqavlslyasgrttgivldsgdgvshtvpiyegyalphailrldla
    grdltdylmkiltergysfttteereivrdikeklcyvaldfeqemataassssleksye
    lkdgqvitignerfrcpealfqpsflgmeacgihettynsimkcdvdirkdlyantvlsg
    gttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskqe
    ydesgpsivhrkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hf4A (A:)
    deevaalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypi
    ehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpa
    myvaiqavlslyasgrttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmk
    iltergysfttteereivrdikeklcyvaldfeqemataassssleksyelkdgqvitig
    nerfrcpealfqpsflgmeacgihettynsimkcdvdirkdlyantvlsggttmypgiad
    rmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivh
    rkcf