PDB entry 2hew

View 2hew on RCSB PDB site
Description: The X-ray crystal structure of murine OX40L
Class: cytokine
Keywords: trimer, TNFSF, cytokine
Deposited on 2006-06-22, released 2006-08-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.168
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Tumor necrosis factor ligand superfamily member 4
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf4, Ox40l, Txgp1l
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hewf1
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hewF (F:)
    gshmssspakdppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiyl
    kgsffqevkidlhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehl
    qindgelivvqltpgycapegsyhstvnqvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hewF (F:)
    ppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiylkgsffqevkid
    lhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehlqindgelivvq
    ltpgycap