PDB entry 2hev

View 2hev on RCSB PDB site
Description: Crystal structure of the complex between OX40L and OX40
Class: cytokine
Keywords: cytokine, receptor-ligand complex, TNFSF, TNFRSF
Deposited on 2006-06-22, released 2006-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.212
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Tumor necrosis factor ligand superfamily member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF4, TXGP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23510 (Start-136)
      • engineered (43)
      • engineered (67)
    Domains in SCOPe 2.06: d2hevf1
  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF4, TXGP1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hevr1, d2hevr2, d2hevr3
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hevF (F:)
    gshmqvshrypriqsikvqfteykkekgfiltsqkedeimkvqdnsviincdgfylislk
    gyfsqevdislhyqkdeeplfqlkkvrsvnslmvasltykdkvylnvttdntslddfhvn
    ggelilihqnpgefcvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hevF (F:)
    riqsikvqfteykkekgfiltsqkedeimkvqdnsviincdgfylislkgyfsqevdisl
    hyqkdeeplfqlkkvrsvnslmvasltykdkvylnvttdntslddfhvnggelilihqnp
    gefcvl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2hevR (R:)
    gshmlhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpc
    twcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpw
    tnctlagkhtlqpasnssdaicedrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hevR (R:)
    lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcn
    lrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnct
    lagkhtlqpasnssdaiced