PDB entry 2het

View 2het on RCSB PDB site
Description: Non-myristoylated bovine recoverin (truncated at C-terminus) with calcium bound to EF-hand 3
Class: metal binding protein
Keywords: Recoverin, EF-hand, helix-loop-helix, calcium binding, METAL BINDING PROTEIN
Deposited on 2006-06-22, released 2006-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recoverin
    Species: Bos taurus [TaxId:9913]
    Gene: RCV1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2heta_
  • Chain 'B':
    Compound: Recoverin
    Species: Bos taurus [TaxId:9913]
    Gene: RCV1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hetb_
  • Chain 'C':
    Compound: Recoverin
    Species: Bos taurus [TaxId:9913]
    Gene: RCV1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hetc_
  • Chain 'D':
    Compound: Recoverin
    Species: Bos taurus [TaxId:9913]
    Gene: RCV1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hetd_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hetA (A:)
    gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
    pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
    vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
    ilrliqfep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hetA (A:)
    lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
    vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
    ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
    ep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hetB (B:)
    gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
    pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
    vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
    ilrliqfep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hetB (B:)
    lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
    vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
    ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
    ep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hetC (C:)
    gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
    pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
    vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
    ilrliqfep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hetC (C:)
    lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
    vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
    ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
    ep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hetD (D:)
    gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
    pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
    vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
    ilrliqfep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hetD (D:)
    lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
    vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
    ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
    ep