PDB entry 2heq

View 2heq on RCSB PDB site
Description: NMR Structure of Bacillus subtilis protein YorP, Northeast Structural Genomics Target SR399.
Class: structural genomics, unknown function
Keywords: SH3-like, NMR structure, BSU2030, YorP, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2006-06-21, released 2006-08-15
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-15, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: YorP protein
  Species: Bacillus subtilis
  Gene: yorP
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31898 (6-75)
    • cloning artifact (0-5)
    • cloning artifact (76-77)
    • his tag (78-83)
  Domains in SCOP 1.75: d2heqa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2heqA (A:)
  magdplpkywsypvglaveinnnarygcphhvgrkgkiiehlhsatydyavsdetgdity
  fkeheltplkgglayvlehhhhhh