PDB entry 2heq

View 2heq on RCSB PDB site
Description: NMR Structure of Bacillus subtilis protein YorP, Northeast Structural Genomics Target SR399.
Class: structural genomics, unknown function
Keywords: SH3-like, NMR structure, BSU2030, YorP, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-06-21, released 2006-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YorP protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yorP
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31898 (6-75)
      • cloning artifact (0-5)
      • cloning artifact (76-77)
      • expression tag (78-83)
    Domains in SCOPe 2.08: d2heqa1, d2heqa2, d2heqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2heqA (A:)
    magdplpkywsypvglaveinnnarygcphhvgrkgkiiehlhsatydyavsdetgdity
    fkeheltplkgglayvlehhhhhh