PDB entry 2heh

View 2heh on RCSB PDB site
Description: Crystal Structure of the KIF2C motor domain
Class: Structural genomics, structural protein
Keywords: kinesin, motor domain, ADP, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC, structural protein
Deposited on 2006-06-21, released 2006-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIF2C protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF2C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2heha_
  • Heterogens: MG, ADP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hehA (A:)
    mgsshhhhhhssglvprgssfpnwefarmikefratlechpltmtdpieehricvcvrkr
    plnkqelakkeidvisipskclllvhepklkvdltkylenqafcfdfafdetasnevvyr
    ftarplvqtifeggkatcfaygqtgsgkthtmggdlsgkaqnaskgiyamasrdvfllkn
    qpcyrklglevyvtffeiyngklfdllnkkaklrvledgkqqvqvvglqehlvnsaddvi
    kmidmgsacrtsgqtfansnssrshacfqiilrakgrmhgkfslvdlagnergadtssad
    rqtrmegaeinksllalkeciralgqnkahtpfreskltqvlrdsfigensrtcmiatis
    pgissceytlntlryadrvkelsphsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hehA (A:)
    nwefarmikefratlechpltmtdpieehricvcvrkrplnkqelakkeidvisipskcl
    llvhepklkvdltkylenqafcfdfafdetasnevvyrftarplvqtifeggkatcfayg
    qtgsgkthtmgkgiyamasrdvfllknqpcyrklglevyvtffeiyngklfdllnkkakl
    rvledgkqqvqvvglqehlvnsaddvikmidmgsacrnssrshacfqiilrakgrmhgkf
    slvdlagnegaeinksllalkeciralgqnkahtpfreskltqvlrdsfigensrtcmia
    tispgissceytlntlryadrvke