PDB entry 2heg

View 2heg on RCSB PDB site
Description: Phospho-Aspartyl Intermediate Analogue of Apha class B acid phosphatase/phosphotransferase
Class: hydrolase
Keywords: Apha class B Acid Phosphatase/Phosphotransferase, HYDROLASE
Deposited on 2006-06-21, released 2008-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.166
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE22 (0-210)
      • modified residue (42)
    Domains in SCOPe 2.07: d2hega_
  • Chain 'B':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE22 (0-210)
      • modified residue (42)
    Domains in SCOPe 2.07: d2hegb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hegA (A:)
    spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
    tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
    vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
    girilrasnstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hegB (B:)
    spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
    tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
    vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
    girilrasnstykplpqagafgeevivnsey