PDB entry 2hee

View 2hee on RCSB PDB site
Description: contribution of water molecules in the interior of a protein to the conformational stability
Deposited on 1997-09-16, released 1998-01-14
The last revision prior to the SCOP 1.57 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2hee__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hee_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqgn
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv