PDB entry 2hec

View 2hec on RCSB PDB site
Description: contribution of water molecules in the interior of a protein to the conformational stability
Class: hydrolase
Keywords: hydrolase, o-glycosyl, glycosidase
Deposited on 1997-09-16, released 1998-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN LYSOZYME WITH ILE 56 REP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (55)
    Domains in SCOPe 2.06: d2heca_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hecA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygafqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv