PDB entry 2he7

View 2he7 on RCSB PDB site
Description: FERM domain of EPB41L3 (DAL-1)
Class: cell adhesion
Keywords: FERM domain, DAL-1, EPB41L3A, Structural Genomics, Structural Genomics Consortium, SGC, CELL ADHESION
Deposited on 2006-06-21, released 2006-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Band 4.1-like protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: EPB41L3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2he7a1, d2he7a2, d2he7a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2he7A (A:)
    ksmqckvilldgseytcdvekrsrgqvlfdkvcehlnllekdyfgltyrdaenqknwldp
    akeikkqvrsgawhfsfnvkfyppdpaqlseditryylclqlrddivsgrlpcsfvtlal
    lgsytvqselgdydpdecgsdyisefrfapnhtkeledkvielhkshrgmtpaeaemhfl
    enakklsmygvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnnf
    yikirpgefeqfestigfklpnhraakrlwkvcvehhtffrll