PDB entry 2he0

View 2he0 on RCSB PDB site
Description: Crystal structure of a human Notch1 ankyrin domain mutant
Class: signaling protein
Keywords: Notch, Ankyrin, signalling, SIGNALING PROTEIN
Deposited on 2006-06-21, released 2006-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Notch1 preproprotein variant
    Species: Homo sapiens [TaxId:9606]
    Gene: Notch 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46531 (Start-242)
      • engineered (57)
      • engineered (65)
      • cloning artifact (243)
    Domains in SCOPe 2.04: d2he0a_
  • Chain 'B':
    Compound: Notch1 preproprotein variant
    Species: Homo sapiens [TaxId:9606]
    Gene: Notch 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46531 (Start-242)
      • engineered (57)
      • engineered (65)
      • cloning artifact (243)
    Domains in SCOPe 2.04: d2he0b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2he0A (A:)
    mdvnvrgpdgftplmiascsgggletgnseeeedapavisdfiyqgaslhnqtdrtgata
    lhlaaaysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilirnratdldar
    mhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvdaavvllkng
    ankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaqermhhdivr
    lldlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2he0A (A:)
    hnqtdrtgatalhlaaaysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqil
    irnratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnn
    vdaavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdi
    aqermhhdivrlldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2he0B (B:)
    mdvnvrgpdgftplmiascsgggletgnseeeedapavisdfiyqgaslhnqtdrtgata
    lhlaaaysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilirnratdldar
    mhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvdaavvllkng
    ankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaqermhhdivr
    lldlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2he0B (B:)
    qtdrtgatalhlaaaysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilir
    nratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvd
    aavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaq
    ermhhdivrlldl