PDB entry 2hdz

View 2hdz on RCSB PDB site
Description: Crystal Structure Analysis of the UBF HMG box5
Class: protein binding
Keywords: HMG domain, PROTEIN BINDING
Deposited on 2006-06-21, released 2007-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleolar transcription factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hdza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hdzA (A:)
mgklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaed
qkryerelsemrappaatnsskklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2hdzA (A:)
lpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedqkr
yerels