PDB entry 2hdk

View 2hdk on RCSB PDB site
Description: Crystal Structure of Cys315Ala-Cys318Ala Mutant of Human Mitochondrial Branched Chain Aminotransferase
Class: transferase
Keywords: D-aminoacid aminotransferase-like PLP-dependent enzymes, TRANSFERASE
Deposited on 2006-06-20, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Branched-chain-amino-acid aminotransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15382
      • conflict (158)
      • engineered (314)
      • engineered (317)
    Domains in SCOPe 2.07: d2hdka_
  • Chain 'B':
    Compound: Branched-chain-amino-acid aminotransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15382 (Start-364)
      • conflict (158)
      • engineered (314)
      • engineered (317)
    Domains in SCOPe 2.07: d2hdkb_
  • Heterogens: PLP, ACY, COI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hdkA (A:)
    asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
    lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
    irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
    pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
    mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
    eegrvrevfgsgtaaqvapvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
    wmfpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hdkA (A:)
    ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
    passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
    rlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvtpv
    slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn
    ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee
    grvrevfgsgtaaqvapvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm
    fpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hdkB (B:)
    asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
    lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
    irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
    pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
    mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
    eegrvrevfgsgtaaqvapvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
    wmfpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hdkB (B:)
    ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
    passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
    rlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvtpv
    slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn
    ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee
    grvrevfgsgtaaqvapvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm
    fpv