PDB entry 2hdj

View 2hdj on RCSB PDB site
Description: Crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with NADP(H)
Class: oxidoreductase
Keywords: human 3alphahds3, aldo-keto reductase, nadph, akr, akr1c2, oxidoreductase
Deposited on 2006-06-20, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member C2
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C2, DDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hdja_
  • Chain 'B':
    Compound: Aldo-keto reductase family 1 member C2
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C2, DDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hdjb_
  • Heterogens: SO4, NDP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hdjA (A:)
    mdskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq
    vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv
    svkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkp
    glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
    rnvryltldifagppnypfsdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hdjA (A:)
    dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
    glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
    vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
    lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
    calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
    nvryltldifagppnypfsdey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hdjB (B:)
    mdskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq
    vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv
    svkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkp
    glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
    rnvryltldifagppnypfsdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hdjB (B:)
    dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
    glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
    vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
    lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
    calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
    nvryltldifagppnypfsdey