PDB entry 2hdd

View 2hdd on RCSB PDB site
Description: engrailed homeodomain q50k variant dna complex
Deposited on 1998-02-10, released 1998-05-27
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2hdda_
  • Chain 'B':
    Domains in SCOP 1.55: d2hddb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hddA (A:)
rtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfknkrakikks

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hddB (B:)
krprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfknkrakik