PDB entry 2hdb

View 2hdb on RCSB PDB site
Description: HMG-CoA synthase from Enterococcus faecalis. Mutation alanine 110 to glycine
Class: lyase
Keywords: thiolase fold, synthase, protein, mutant, LYASE
Deposited on 2006-06-20, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HMG-CoA synthase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FD71 (0-382)
      • engineered (109)
    Domains in SCOPe 2.07: d2hdba1, d2hdba2
  • Chain 'B':
    Compound: HMG-CoA synthase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FD71 (0-382)
      • engineered (109)
    Domains in SCOPe 2.07: d2hdbb1, d2hdbb2
  • Heterogens: SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hdbA (A:)
    mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae
    ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikegcygataglql
    aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvaseprilalkednvmltq
    diydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfadydalafhipytkmg
    kkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglisllenattltagnq
    iglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaeyeamfaetldtdid
    qtledelkysisainntvrsyrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hdbB (B:)
    mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae
    ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikegcygataglql
    aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvaseprilalkednvmltq
    diydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfadydalafhipytkmg
    kkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglisllenattltagnq
    iglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaeyeamfaetldtdid
    qtledelkysisainntvrsyrn