PDB entry 2hd4

View 2hd4 on RCSB PDB site
Description: Crystal structure of proteinase K inhibited by a lactoferrin octapeptide Gly-Asp-Glu-Gln-Gly-Glu-Asn-Lys at 2.15 A resolution
Class: Hydrolase
Keywords: proteinase K, complex, peptide complex, LACTOFERRIN FRAGMENT, Hydrolase
Deposited on 2006-06-20, released 2006-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Engyodontium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06873 (0-278)
      • see remark 999 (206)
    Domains in SCOPe 2.08: d2hd4a_
  • Chain 'B':
    Compound: 8-mer peptide from Lactotransferrin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hd4A (A:)
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

  • Chain 'B':
    No sequence available.