PDB entry 2hci

View 2hci on RCSB PDB site
Description: Structure of Human Mip-3a Chemokine
Class: immune system
Keywords: macrophage inflammatory protein-3a, Dimer, Space group I4, IMMUNE SYSTEM
Deposited on 2006-06-16, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.209
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small inducible cytokine A20
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hcia1
  • Chain 'B':
    Compound: Small inducible cytokine A20
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hcib1
  • Heterogens: SO4, SO3, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hciA (A:)
    asnfdcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyiv
    rllskkvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hciA (A:)
    snfdcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivr
    llskkvkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hciB (B:)
    asnfdcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyiv
    rllskkvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hciB (B:)
    dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
    kkvkn