PDB entry 2hcc

View 2hcc on RCSB PDB site
Description: solution structure of the human chemokine hcc-2, nmr, 30 structures
Deposited on 1998-07-03, released 1999-07-13
The last revision prior to the SCOP 1.59 freeze date was dated 1999-07-13, with a file datestamp of 1999-07-12.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d2hcc__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hcc_ (-)
  hfaadcctsyisqsipcslmksyfetssecskpgvifltkkgrqvcakpsgpgvqdcmkk
  lkpysi