PDB entry 2hcc

View 2hcc on RCSB PDB site
Description: solution structure of the human chemokine hcc-2, nmr, 30 structures
Class: chemokine
Keywords: chemokine, human, nmr structure, hcc-2, mip-5, leukotactin-1, chemotaxis, cc-chemokine
Deposited on 1998-07-03, released 1999-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human chemokine hcc-2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16663 (0-65)
  Domains in SCOPe 2.08: d2hcca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hccA (A:)
  hfaadcctsyisqsipcslmksyfetssecskpgvifltkkgrqvcakpsgpgvqdcmkk
  lkpysi