PDB entry 2hcb

View 2hcb on RCSB PDB site
Description: Structure of AMPPCP-bound DnaA from Aquifex aeolicus
Class: replication
Keywords: AAA+ ATPase, Helix-turn-helix, REPLICATION
Deposited on 2006-06-15, released 2006-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 3.51 Å
R-factor: 0.267
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromosomal replication initiator protein dnaA
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: dnaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hcba1, d2hcba2
  • Chain 'B':
    Compound: Chromosomal replication initiator protein dnaA
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: dnaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hcbb1, d2hcbb2
  • Chain 'C':
    Compound: Chromosomal replication initiator protein dnaA
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: dnaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hcbc1, d2hcbc2
  • Chain 'D':
    Compound: Chromosomal replication initiator protein dnaA
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: dnaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hcbd1, d2hcbd2
  • Heterogens: MG, ACP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hcbA (A:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdkrnkrtsearkiamylcrkvcsaslieiarafkrkdhttvihairsveee
    kkkdrkfkhlvgflekqafdkic
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hcbA (A:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdkrrtsearkiamylcrkvcsaslieiarafkdhttvihairsveeekkrk
    fkhlvgflekqafdkic
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hcbB (B:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdkrnkrtsearkiamylcrkvcsaslieiarafkrkdhttvihairsveee
    kkkdrkfkhlvgflekqafdkic
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hcbB (B:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdknkrtsearkiamylcrkvcsaslieiarafkdhttvihairsveeekkr
    kfkhlvgflekqafdkic
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hcbC (C:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdkrnkrtsearkiamylcrkvcsaslieiarafkrkdhttvihairsveee
    kkkdrkfkhlvgflekqafdkic
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hcbC (C:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdknkrtsearkiamylcrkvcsaslieiarafdhttvihairsveeekkrk
    fkhlvgflekqafdkic
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hcbD (D:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdkrnkrtsearkiamylcrkvcsaslieiarafkrkdhttvihairsveee
    kkkdrkfkhlvgflekqafdkic
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hcbD (D:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdknkrtsearkiamylcrkvcsaslieiarafkrkdhttvihairsveeek
    krkfkhlvgflekqafdkic