PDB entry 2hbx

View 2hbx on RCSB PDB site
Description: Crystal Structure of alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde-Decarboxylase (ACMSD)
Class: lyase
Keywords: ACMSD, TIM-barrel, Decarboxylase, Metaloenzyme, LYASE
Deposited on 2006-06-14, released 2006-09-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2hbxa_
  • Chain 'B':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2hbxb_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hbxA (A:)
    mkkpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdp
    afrieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaq
    vplqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwd
    mmggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrv
    dnawrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplg
    eqkigglvlssnlgesakdkiisgnaskffninv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hbxA (A:)
    kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
    rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
    lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
    ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn
    awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
    kigglvlssnlgesakdkiisgnaskffninv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hbxB (B:)
    mkkpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdp
    afrieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaq
    vplqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwd
    mmggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrv
    dnawrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplg
    eqkigglvlssnlgesakdkiisgnaskffninv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hbxB (B:)
    kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
    rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
    lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
    ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn
    awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
    kigglvlssnlgesakdkiisgnaskffninv