PDB entry 2hbo

View 2hbo on RCSB PDB site
Description: Crystal structure of a thioesterase superfamily protein with unknown function (np_422103.1) from Caulobacter crescentus at 1.85 A resolution
Class: structural genomics, unknown function
Keywords: np_422103.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2006-06-14, released 2006-08-08
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein (np_422103.1)
  Species: Caulobacter crescentus
  Gene: np_422103.1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9A395
    • modified residue (64)
    • modified residue (66)
    • modified residue (71)
    • modified residue (91)
    • modified residue (116)
  Domains in SCOP 1.73: d2hboa1
• Heterogens: PE4, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hboA (A:)
  gmsddltdaqtaaipegfsqlnwsrgfgrqigplfehregpgqarlafrveehhtnglgn
  chggmlmsfadmawgriislqksyswvtvrlmcdflsgaklgdwvegegeliseedmlft
  vrgriwagertlitgtgvfkalsarkprpgelaykeea
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hboA (A:)
  aipegfsqlnwsrgfgrqigplfehregpgqarlafrveehhtnglgnchggmlmsfadm
  awgriislqksyswvtvrlmcdflsgaklgdwvegegeliseedmlftvrgriwagertl
  itgtgvfkalsarkprpgelay