PDB entry 2hbm

View 2hbm on RCSB PDB site
Description: Structure of the yeast nuclear exosome component, Rrp6p, reveals an interplay between the active site and the HRDC domain; Protein in complex with Mn, Zn, and UMP
Class: hydrolase, gene regulation
Keywords: exosome, RNA metabolism, RNA surveillance, RNA processing, HYDROLASE, GENE REGULATION
Deposited on 2006-06-14, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exosome complex exonuclease RRP6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RRP6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12149 (2-End)
      • cloning artifact (0-1)
      • engineered (234)
    Domains in SCOPe 2.08: d2hbma1, d2hbma2, d2hbma3
  • Heterogens: ZN, MN, U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hbmA (A:)
    gmvekpqlkfkspidnseshpfipllkekpnalkplseslrlvdddennpshyphpyeye
    idhqeyspeilqireeipskswddsvpiwvdtstelesmledlkntkeiavdlehhdyrs
    yygivclmqistrerdylvdtlklrenlhilnevftnpsivkvfhgafmdiiwlqrdlgl
    yvvglfdtyhaskaiglprhslayllenfanfktskkyqladwrirplskpmtaaaradt
    hfllniydqlrnkliesnklagvlyesrnvakrrfeyskyrpltpssevyspiekespwk
    ilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdvigvvsl
    tngvtehvrqnakllanlirdalrnikntneeatpipssetkadgillet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hbmA (A:)
    gmvekpqlkfkspidnseshpfipllkekpnalkplseslrlvdddennpshyphpyeye
    idhqeyspeilqireeipskswddsvpiwvdtstelesmledlkntkeiavdlehhdyrs
    yygivclmqistrerdylvdtlklrenlhilnevftnpsivkvfhgafmdiiwlqrdlgl
    yvvglfdtyhaskaiglprhslayllenfanfktskkyqladwrirplskpmtaaaradt
    hfllniydqlrnkliesnklagvlyesrnvakrrfeyskyrpltpssevyspiekespwk
    ilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdvigvvsl
    tngvtehvrqnakllanlirdalrnikntn