PDB entry 2hbj

View 2hbj on RCSB PDB site
Description: Structure of the yeast nuclear exosome component, Rrp6p, reveals an interplay between the active site and the HRDC domain
Class: hydrolase, gene regulation
Keywords: exosome, RNA metabolism, RNA surveillance, RNA processing
Deposited on 2006-06-14, released 2006-07-25
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.232
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exosome complex exonuclease RRP6
    Species: Saccharomyces cerevisiae
    Gene: RRP6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12149 (2-End)
      • cloning artifact (0-1)
      • engineered (234)
    Domains in SCOP 1.75: d2hbja1, d2hbja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hbjA (A:)
    gmvekpqlkfkspidnseshpfipllkekpnalkplseslrlvdddennpshyphpyeye
    idhqeyspeilqireeipskswddsvpiwvdtstelesmledlkntkeiavdlehhdyrs
    yygivclmqistrerdylvdtlklrenlhilnevftnpsivkvfhgafmdiiwlqrdlgl
    yvvglfdtyhaskaiglprhslayllenfanfktskkyqladwrirplskpmtaaaradt
    hfllniydqlrnkliesnklagvlyesrnvakrrfeyskyrpltpssevyspiekespwk
    ilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdvigvvsl
    tngvtehvrqnakllanlirdalrnikntneeatpipssetkadgillet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hbjA (A:)
    gmvekpqlkfkspidnseshpfipllkekpnalkplseslrlvdddennpshyphpyeye
    idhqeyspeilqireeipskswddsvpiwvdtstelesmledlkntkeiavdlehhdyrs
    yygivclmqistrerdylvdtlklrenlhilnevftnpsivkvfhgafmdiiwlqrdlgl
    yvvglfdtyhaskaiglprhslayllenfanfktskkyqladwrirplskpmtaaaradt
    hfllniydqlrnkliesnklagvlyesrnvakrrfeyskyrpltpssevyspiekespwk
    ilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdvigvvsl
    tngvtehvrqnakllanlirdalrnikntn