PDB entry 2hbb

View 2hbb on RCSB PDB site
Description: Crystal Structure of the N-terminal Domain of Ribosomal Protein L9 (NTL9)
Class: RNA binding protein
Keywords: L9, ribosomal protein, NTL9, RNA BINDING PROTEIN
Deposited on 2006-06-14, released 2007-05-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L9
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: rplI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2hbba1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hbbA (A:)
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqk