PDB entry 2hba

View 2hba on RCSB PDB site
Description: Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9) K12M
Class: RNA binding protein
Keywords: L9, ribosomal protein, NTL9, K12M
Deposited on 2006-06-14, released 2007-05-29
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.145
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 50S ribosomal protein L9
  Species: Bacillus stearothermophilus
  Gene: rplI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02417 (0-51)
    • engineered (11)
  Domains in SCOP 1.75: d2hbaa1
• Chain 'B':
  Compound: 50S ribosomal protein L9
  Species: Bacillus stearothermophilus
  Gene: rplI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02417 (0-51)
    • engineered (11)
  Domains in SCOP 1.75: d2hbab1
• Heterogens: ZN, CL, IMD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hbaA (A:)
  mkviflkdvkgmgkkgeiknvadgyannflfkqglaieatpanlkaleaqkq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hbaB (B:)
  mkviflkdvkgmgkkgeiknvadgyannflfkqglaieatpanlkaleaqkq